SCOPe 2.06: Domain d3fhia_: 3fhi A:

Lineage for d3fhia_ (3fhi A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (5 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56119] (30 PDB entries)

8. Domain d3fhia_: 3fhi A: [175783]
   automated match to d1cmke_
   complexed with anp, mn

Details for d3fhia_

PDB Entry: 3fhi, 2 Å

PDB Description: crystal structure of a complex between the catalytic and regulatory (ri{alpha}) subunits of pka

PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d3fhia_:

Sequence; same for both SEQRES and ATOM records:

>d3fhia_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}
esvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhyamk
ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshl
rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk
grtwtlagtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs
gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
pfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

Timeline for d3fhia_:

• d3fhia_ first appeared in SCOPe 2.01
  
• d3fhia_ appears in SCOPe 2.05
  
• d3fhia_ appears in SCOPe 2.07
  
• d3fhia_ appears in the current release, SCOPe 2.08