Lineage for d3fhia_ (3fhi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980113Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 2980203Species Mouse (Mus musculus) [TaxId:10090] [56119] (33 PDB entries)
  8. 2980218Domain d3fhia_: 3fhi A: [175783]
    automated match to d1cmke_
    complexed with anp, mn

Details for d3fhia_

PDB Entry: 3fhi (more details), 2 Å

PDB Description: crystal structure of a complex between the catalytic and regulatory (ri{alpha}) subunits of pka
PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d3fhia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhia_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}
esvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhyamk
ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshl
rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk
grtwtlagtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs
gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
pfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

SCOPe Domain Coordinates for d3fhia_:

Click to download the PDB-style file with coordinates for d3fhia_.
(The format of our PDB-style files is described here.)

Timeline for d3fhia_: