| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class pi GST [81347] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47619] (66 PDB entries) |
| Domain d1eohe1: 1eoh E:77-209 [17578] Other proteins in same PDB: d1eoha2, d1eohb2, d1eohc2, d1eohd2, d1eohe2, d1eohf2, d1eohg2, d1eohh2 |
PDB Entry: 1eoh (more details), 2.5 Å
SCOPe Domain Sequences for d1eohe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eohe1 a.45.1.1 (E:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfaaynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq
Timeline for d1eohe1: