Lineage for d3fgsa_ (3fgs A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2914985Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2915132Protein automated matches [190754] (1 species)
    not a true protein
  7. 2915133Species Human (Homo sapiens) [TaxId:9606] [187949] (3 PDB entries)
  8. 2915135Domain d3fgsa_: 3fgs A: [175775]
    automated match to d1bp5c_
    complexed with co3, fe; mutant

Details for d3fgsa_

PDB Entry: 3fgs (more details), 1.8 Å

PDB Description: crystal structure of g65r/k206e double mutant of the n-lobe human transferrin
PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d3fgsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fgsa_ c.94.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
darlvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvehstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtc

SCOPe Domain Coordinates for d3fgsa_:

Click to download the PDB-style file with coordinates for d3fgsa_.
(The format of our PDB-style files is described here.)

Timeline for d3fgsa_: