SCOPe 2.08: Domain d3fgpb1: 3fgp B:1-323

Lineage for d3fgpb1 (3fgp B:1-323)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.0: automated matches [191338] (1 protein)
   not a true family

6. Protein automated matches [190215] (38 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [188598] (7 PDB entries)

8. Domain d3fgpb1: 3fgp B:1-323 [175774]
   Other proteins in same PDB: d3fgpb2
   automated match to d2bhsa1

Details for d3fgpb1

PDB Entry: 3fgp, 2.05 Å

PDB Description: 2.05 a crystal structure of cysm from mycobacterium tuberculosis - open and closed conformations

PDB Compounds: (B:) Cysteine synthase B

SCOPe Domain Sequences for d3fgpb1:

Sequence; same for both SEQRES and ATOM records:

>d3fgpb1 c.79.1.0 (B:1-323) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
marydsllqalgntplvglqrlsprwddgrdgphvrlwakledrnptgsikdrpavrmie
qaeadgllrpgatileptsgntgislamaarlkgyrlicvmpentsverrqllelygaqi
ifsaaeggsntavatakelaatnpswvmlyqygnpantdshycgtgpelladlpeithfv
aglgttgtlmgtgrflrehvanvkivaaeprygegvyalrnmdegfvpelydpeiltary
svgavdavrrtrelvhtegifagistgavlhaalgvgagalaageradialvvadagwky
lstgayagslddaetalegqlwa

Timeline for d3fgpb1:

• d3fgpb1 first appeared in SCOPe 2.01, called d3fgpb_
  
• d3fgpb1 appears in SCOPe 2.07