SCOPe 2.05: Domain d3fgpa_: 3fgp A:

Lineage for d3fgpa_ (3fgp A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.0: automated matches [191338] (1 protein)
   not a true family

6. Protein automated matches [190215] (23 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [188598] (5 PDB entries)

8. Domain d3fgpa_: 3fgp A: [175773]
   automated match to d2bhsa1

Details for d3fgpa_

PDB Entry: 3fgp, 2.05 Å

PDB Description: 2.05 a crystal structure of cysm from mycobacterium tuberculosis - open and closed conformations

PDB Compounds: (A:) Cysteine synthase B

SCOPe Domain Sequences for d3fgpa_:

Sequence; same for both SEQRES and ATOM records:

>d3fgpa_ c.79.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rydsllqalgntplvglqrlsprwddgrdgphvrlwakledrnptgsikdrpavrmieqa
eadgllrpgatileptsgntgislamaarlkgyrlicvmpentsverrqllelygaqiif
saaeggsntavatakelaatnpswvmlyqygnpantdshycgtgpelladlpeithfvag
lgttgtlmgtgrflrehvanvkivaaeprygegvyalrnmdegfvpelydpeiltarysv
gavdavrrtrelvhtegifagistgavlhaalgvgagalaageradialvvadagwkyls
tgayagslddae

Timeline for d3fgpa_:

• d3fgpa_ first appeared in SCOPe 2.01
  
• d3fgpa_ appears in SCOPe 2.04
  
• d3fgpa_ appears in SCOPe 2.06
  
• d3fgpa_ appears in the current release, SCOPe 2.08