SCOPe 2.08: Domain d3fgcd1: 3fgc D:1-324

Lineage for d3fgcd1 (3fgc D:1-324)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families)
   consists of clearly related families of somewhat different folds

5. Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (3 proteins)
   typical (beta/alpha)8-barrel fold
   heterodimer of two similar chains

6. Protein automated matches [191049] (2 species)
   not a true protein

7. Species Vibrio harveyi [TaxId:669] [188897] (1 PDB entry)

8. Domain d3fgcd1: 3fgc D:1-324 [175772]
   Other proteins in same PDB: d3fgcd2
   automated match to d1bslb_
   complexed with fmn, po4, so4

Details for d3fgcd1

PDB Entry: 3fgc, 2.3 Å

PDB Description: crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication

PDB Compounds: (D:) Alkanal monooxygenase beta chain

SCOPe Domain Sequences for d3fgcd1:

Sequence; same for both SEQRES and ATOM records:

>d3fgcd1 c.1.16.1 (D:1-324) automated matches {Vibrio harveyi [TaxId: 669]}
mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
smedkaqqravidvvnanivkyhs

Timeline for d3fgcd1:

• d3fgcd1 first appeared in SCOPe 2.01, called d3fgcd_
  
• d3fgcd1 appears in SCOPe 2.07