Lineage for d3fgcb_ (3fgc B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839499Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2839500Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (3 proteins)
    typical (beta/alpha)8-barrel fold
    heterodimer of two similar chains
  6. 2839515Protein automated matches [191049] (2 species)
    not a true protein
  7. 2839521Species Vibrio harveyi [TaxId:669] [188897] (1 PDB entry)
  8. 2839523Domain d3fgcb_: 3fgc B: [175770]
    Other proteins in same PDB: d3fgcd2
    automated match to d1bslb_
    complexed with fmn, po4, so4

Details for d3fgcb_

PDB Entry: 3fgc (more details), 2.3 Å

PDB Description: crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication
PDB Compounds: (B:) Alkanal monooxygenase beta chain

SCOPe Domain Sequences for d3fgcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fgcb_ c.1.16.1 (B:) automated matches {Vibrio harveyi [TaxId: 669]}
mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
smedkaqqravidvvnan

SCOPe Domain Coordinates for d3fgcb_:

Click to download the PDB-style file with coordinates for d3fgcb_.
(The format of our PDB-style files is described here.)

Timeline for d3fgcb_: