Lineage for d3fgaa_ (3fga A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006480Family a.118.1.2: HEAT repeat [48385] (2 protein domains)
    Pfam PF02985
  6. 2006481Protein Constant regulatory domain of protein phosphatase 2a, pr65alpha [48386] (2 species)
  7. 2006503Species Mouse (Mus musculus) [TaxId:10090] [189044] (2 PDB entries)
  8. 2006504Domain d3fgaa_: 3fga A: [175767]
    Other proteins in same PDB: d3fgac_
    automated match to d1b3ua_
    complexed with mn

Details for d3fgaa_

PDB Entry: 3fga (more details), 2.7 Å

PDB Description: structural basis of pp2a and sgo interaction
PDB Compounds: (A:) Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

SCOPe Domain Sequences for d3fgaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fgaa_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Mouse (Mus musculus) [TaxId: 10090]}
ddslypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevl
lalaeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdlea
hfvplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaa
sklgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmp
tlrqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkv
kefcenlsadcrenvimtqilpcikelvsdanqhvksalasvimglspilgkdntiehll
plflaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiiey
mpllagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkv
lamsgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqk
igpildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla

SCOPe Domain Coordinates for d3fgaa_:

Click to download the PDB-style file with coordinates for d3fgaa_.
(The format of our PDB-style files is described here.)

Timeline for d3fgaa_: