Lineage for d3fg5a_ (3fg5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733374Species Daboia russelli [TaxId:97228] [188715] (1 PDB entry)
  8. 2733375Domain d3fg5a_: 3fg5 A: [175766]
    automated match to d1tgma_
    complexed with ajm

Details for d3fg5a_

PDB Entry: 3fg5 (more details), 2.5 Å

PDB Description: Crystal structure determination of a ternary complex of phospholipase A2 with a pentapetide FLSYK and Ajmaline at 2.5 A resolution
PDB Compounds: (A:) Group II Phospholipase A2

SCOPe Domain Sequences for d3fg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fg5a_ a.133.1.2 (A:) automated matches {Daboia russelli [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d3fg5a_:

Click to download the PDB-style file with coordinates for d3fg5a_.
(The format of our PDB-style files is described here.)

Timeline for d3fg5a_: