Lineage for d3ffqb_ (3ffq B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426017Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2426023Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2426174Protein automated matches [190352] (9 species)
    not a true protein
  7. 2426224Species Mouse (Mus musculus) [TaxId:10090] [187178] (3 PDB entries)
  8. 2426228Domain d3ffqb_: 3ffq B: [175759]
    automated match to d1q5oa_
    complexed with br

Details for d3ffqb_

PDB Entry: 3ffq (more details), 2.4 Å

PDB Description: HCN2I 443-640 apo-state
PDB Compounds: (B:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d3ffqb_:

Sequence, based on SEQRES records: (download)

>d3ffqb_ b.82.3.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetva

Sequence, based on observed residues (ATOM records): (download)

>d3ffqb_ b.82.3.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrraf
etva

SCOPe Domain Coordinates for d3ffqb_:

Click to download the PDB-style file with coordinates for d3ffqb_.
(The format of our PDB-style files is described here.)

Timeline for d3ffqb_: