SCOPe 2.07: Domain d3ffqa_: 3ffq A:

Lineage for d3ffqa_ (3ffq A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187178] (3 PDB entries)

8. Domain d3ffqa_: 3ffq A: [175758]
   automated match to d1q5oa_
   complexed with br

Details for d3ffqa_

PDB Entry: 3ffq, 2.4 Å

PDB Description: HCN2I 443-640 apo-state

PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d3ffqa_:

Sequence, based on SEQRES records:

>d3ffqa_ b.82.3.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplreeiv
nfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvvsv
ltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrra
fetvai

Sequence, based on observed residues (ATOM records):

>d3ffqa_ b.82.3.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplreeiv
nfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvvsv
ltnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrrafe
tvai

Timeline for d3ffqa_:

• d3ffqa_ first appeared in SCOPe 2.01
  
• d3ffqa_ appears in SCOPe 2.06
  
• d3ffqa_ appears in the current release, SCOPe 2.08