Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein HIV-1 reverse transcriptase [56689] (3 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (126 PDB entries) Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595 |
Domain d3ffib_: 3ffi B: [175756] automated match to d1c1cb_ complexed with 3ob |
PDB Entry: 3ffi (more details), 2.6 Å
SCOPe Domain Sequences for d3ffib_:
Sequence, based on SEQRES records: (download)
>d3ffib_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]} ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqym ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk lwyq
>d3ffib_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]} ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik stkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrky taftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddl yvgsdleigqhrtkieelrqhllrwglttwmgyelhpdkwtvqpivlpekdswtvndiqk lvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyy dpskdliaeiqkqgqgqwtyqiyqepfknlktgkyatndvkqlteavqkittesiviwgk tpkfklpiqketwetwwteywqatwipewefvntpplvklwyq
Timeline for d3ffib_: