Lineage for d3ffhb_ (3ffh B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1000625Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1000626Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1001696Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1001697Protein automated matches [190151] (25 species)
    not a true protein
  7. 1001774Species Listeria innocua [TaxId:1642] [188713] (1 PDB entry)
  8. 1001776Domain d3ffhb_: 3ffh B: [175755]
    automated match to d1fg3a_
    complexed with so4

Details for d3ffhb_

PDB Entry: 3ffh (more details), 2.31 Å

PDB Description: The crystal structure of histidinol-phosphate aminotransferase from Listeria innocua Clip11262.
PDB Compounds: (B:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3ffhb_:

Sequence, based on SEQRES records: (download)

>d3ffhb_ c.67.1.0 (B:) automated matches {Listeria innocua [TaxId: 1642]}
amkwkkslaglssykpgkreeevmaelgltkitklssnenplgtskkvaaiqanssvete
iypdgwasslrkevadfyqleeeeliftagvdelielltrvlldtttntvmatptfvqyr
qnaliegaevreipllqdgehdlegmlnaidekttivwicnpnnptgnyieladiqafld
rvpsdvlvvldeayieyvtpqpekheklvrtyknliitrtfskiyglasarvgygiadke
iirqlnivrppfnttsigqklaieaikdqafigecrtsnangikqyeafakrfekvklyp
angnfvlidlgieagtifsylekngyitrsgaalgfptavritigkeednsaviallekl
l

Sequence, based on observed residues (ATOM records): (download)

>d3ffhb_ c.67.1.0 (B:) automated matches {Listeria innocua [TaxId: 1642]}
amkwkkslaglsreeevmaelgltkitklssnenplgtskkvaaiqanssveteiypass
lrkevadfyqleeeeliftagvdelielltrvlldtttntvmatptfvqyrqnaliegae
vreipllqdgehdlegmlnaidekttivwicnpnnptgnyieladiqafldrvpsdvlvv
ldeayieyvtpqpekheklvrtyknliitrtfskiyglasarvgygiadkeiirqlnivr
ppfnttsigqklaieaikdqafigecrtsnangikqyeafakrfekvklypangnfvlid
lgieagtifsylekngyitrsgaalgfptavritigkeednsaviallekll

SCOPe Domain Coordinates for d3ffhb_:

Click to download the PDB-style file with coordinates for d3ffhb_.
(The format of our PDB-style files is described here.)

Timeline for d3ffhb_: