Lineage for d3ffhb1 (3ffh B:1-360)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132622Species Listeria innocua [TaxId:1642] [188713] (1 PDB entry)
  8. 2132624Domain d3ffhb1: 3ffh B:1-360 [175755]
    Other proteins in same PDB: d3ffha2, d3ffhb2
    automated match to d1fg3a_
    complexed with so4

Details for d3ffhb1

PDB Entry: 3ffh (more details), 2.31 Å

PDB Description: The crystal structure of histidinol-phosphate aminotransferase from Listeria innocua Clip11262.
PDB Compounds: (B:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3ffhb1:

Sequence, based on SEQRES records: (download)

>d3ffhb1 c.67.1.0 (B:1-360) automated matches {Listeria innocua [TaxId: 1642]}
mkwkkslaglssykpgkreeevmaelgltkitklssnenplgtskkvaaiqanssvetei
ypdgwasslrkevadfyqleeeeliftagvdelielltrvlldtttntvmatptfvqyrq
naliegaevreipllqdgehdlegmlnaidekttivwicnpnnptgnyieladiqafldr
vpsdvlvvldeayieyvtpqpekheklvrtyknliitrtfskiyglasarvgygiadkei
irqlnivrppfnttsigqklaieaikdqafigecrtsnangikqyeafakrfekvklypa
ngnfvlidlgieagtifsylekngyitrsgaalgfptavritigkeednsaviallekll

Sequence, based on observed residues (ATOM records): (download)

>d3ffhb1 c.67.1.0 (B:1-360) automated matches {Listeria innocua [TaxId: 1642]}
mkwkkslaglsreeevmaelgltkitklssnenplgtskkvaaiqanssveteiypassl
rkevadfyqleeeeliftagvdelielltrvlldtttntvmatptfvqyrqnaliegaev
reipllqdgehdlegmlnaidekttivwicnpnnptgnyieladiqafldrvpsdvlvvl
deayieyvtpqpekheklvrtyknliitrtfskiyglasarvgygiadkeiirqlnivrp
pfnttsigqklaieaikdqafigecrtsnangikqyeafakrfekvklypangnfvlidl
gieagtifsylekngyitrsgaalgfptavritigkeednsaviallekll

SCOPe Domain Coordinates for d3ffhb1:

Click to download the PDB-style file with coordinates for d3ffhb1.
(The format of our PDB-style files is described here.)

Timeline for d3ffhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ffhb2