SCOPe 2.07: Domain d3ff9b1: 3ff9 B:75-189

Lineage for d3ff9b1 (3ff9 B:75-189)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (27 PDB entries)

8. Domain d3ff9b1: 3ff9 B:75-189 [175749]
   Other proteins in same PDB: d3ff9a2, d3ff9b2
   automated match to d1b6ea_

Details for d3ff9b1

PDB Entry: 3ff9, 1.8 Å

PDB Description: structure of nk cell receptor klrg1

PDB Compounds: (B:) Killer cell lectin-like receptor subfamily G member 1

SCOPe Domain Sequences for d3ff9b1:

Sequence; same for both SEQRES and ATOM records:

>d3ff9b1 d.169.1.0 (B:75-189) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cpilwtrngshcyyfsmekkdwnsslkfcadkgshlltfpdnqgvklfgeylgqdfywig
lrnidgwrweggpalslriltnsliqrcgaihrnglqasscevalqwickkvly

Timeline for d3ff9b1:

• d3ff9b1 first appeared in SCOPe 2.01, called d3ff9b_
  
• d3ff9b1 appears in SCOPe 2.06