Lineage for d3ff8d_ (3ff8 D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (17 species)
    not a true protein
  7. 2559977Species Mouse (Mus musculus) [TaxId:10090] [187331] (22 PDB entries)
  8. 2560001Domain d3ff8d_: 3ff8 D: [175747]
    Other proteins in same PDB: d3ff8a1, d3ff8a2, d3ff8b1, d3ff8b2
    automated match to d1b6ea_
    complexed with ca

Details for d3ff8d_

PDB Entry: 3ff8 (more details), 2 Å

PDB Description: structure of nk cell receptor klrg1 bound to e-cadherin
PDB Compounds: (D:) Killer cell lectin-like receptor subfamily G member 1

SCOPe Domain Sequences for d3ff8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ff8d_ d.169.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cpilwtrngshcyyfsmekkdwnsslkfcadkgshlltfpdnqgvklfgeylgqdfywig
lrnidgwrweggpalslriltnsliqrcgaihrnglqasscevalqwickkvl

SCOPe Domain Coordinates for d3ff8d_:

Click to download the PDB-style file with coordinates for d3ff8d_.
(The format of our PDB-style files is described here.)

Timeline for d3ff8d_: