Lineage for d3ff8b1 (3ff8 B:1-99)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763415Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2763423Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 2763424Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries)
  8. 2763441Domain d3ff8b1: 3ff8 B:1-99 [175745]
    Other proteins in same PDB: d3ff8a2, d3ff8b2, d3ff8c_, d3ff8d_
    automated match to d1o6sb_
    complexed with ca

Details for d3ff8b1

PDB Entry: 3ff8 (more details), 2 Å

PDB Description: structure of nk cell receptor klrg1 bound to e-cadherin
PDB Compounds: (B:) epithelial cadherin

SCOPe Domain Sequences for d3ff8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ff8b1 b.1.6.1 (B:1-99) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
dwvippislpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwl
kvtepldreriatytlfshavssngnavedpmeilitvt

SCOPe Domain Coordinates for d3ff8b1:

Click to download the PDB-style file with coordinates for d3ff8b1.
(The format of our PDB-style files is described here.)

Timeline for d3ff8b1: