Lineage for d3ff8a_ (3ff8 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1768943Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1768951Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1768952Species Human (Homo sapiens) [TaxId:9606] [81981] (10 PDB entries)
  8. 1768964Domain d3ff8a_: 3ff8 A: [175744]
    Other proteins in same PDB: d3ff8c_, d3ff8d_
    automated match to d1o6sb_
    complexed with ca

Details for d3ff8a_

PDB Entry: 3ff8 (more details), 2 Å

PDB Description: structure of nk cell receptor klrg1 bound to e-cadherin
PDB Compounds: (A:) epithelial cadherin

SCOPe Domain Sequences for d3ff8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ff8a_ b.1.6.1 (A:) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
mdwvippislpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgw
lkvtepldreriatytlfshavssngnavedpmeilitvtd

SCOPe Domain Coordinates for d3ff8a_:

Click to download the PDB-style file with coordinates for d3ff8a_.
(The format of our PDB-style files is described here.)

Timeline for d3ff8a_: