SCOPe 2.03: Domain d3ff7d_: 3ff7 D:

Lineage for d3ff7d_ (3ff7 D:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries)

8. Domain d3ff7d_: 3ff7 D: [175743]
   Other proteins in same PDB: d3ff7a_, d3ff7b_
   automated match to d1k9jb_
   complexed with acy

Details for d3ff7d_

PDB Entry: 3ff7, 1.8 Å

PDB Description: structure of nk cell receptor klrg1 bound to e-cadherin

PDB Compounds: (D:) Killer cell lectin-like receptor subfamily G member 1

SCOPe Domain Sequences for d3ff7d_:

Sequence; same for both SEQRES and ATOM records:

>d3ff7d_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpdrwmkygnhcyyfsveekdwnsslefclardshllvitdnqemsllqvflseafswig
lrnnsgwrwedgsplnfsrissnsfvqtcgainknglqasscevplhwvckk

Timeline for d3ff7d_:

• d3ff7d_ first appeared in SCOPe 2.01
  
• d3ff7d_ appears in SCOPe 2.02
  
• d3ff7d_ appears in SCOPe 2.04
  
• d3ff7d_ appears in the current release, SCOPe 2.08