Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (3 families) |
Family b.1.6.1: Cadherin [49314] (3 proteins) |
Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
Species Human (Homo sapiens) [TaxId:9606] [81981] (10 PDB entries) |
Domain d3ff7b_: 3ff7 B: [175741] Other proteins in same PDB: d3ff7c_, d3ff7d_ automated match to d1o6sb_ complexed with acy |
PDB Entry: 3ff7 (more details), 1.8 Å
SCOPe Domain Sequences for d3ff7b_:
Sequence, based on SEQRES records: (download)
>d3ff7b_ b.1.6.1 (B:) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} mdwvippislpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgw lkvtepldreriatytlfshavssngnavedpmeilitvt
>d3ff7b_ b.1.6.1 (B:) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} mdwvippislpengpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlk vtepldreriatytlfshavssngnavedpmeilitvt
Timeline for d3ff7b_: