Lineage for d3ff1a1 (3ff1 A:1-443)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140302Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2140362Protein automated matches [190137] (5 species)
    not a true protein
  7. 2140392Species Staphylococcus aureus [TaxId:93062] [188767] (1 PDB entry)
  8. 2140393Domain d3ff1a1: 3ff1 A:1-443 [175738]
    Other proteins in same PDB: d3ff1a2, d3ff1b2
    automated match to d1b0za_
    complexed with g6q, na

Details for d3ff1a1

PDB Entry: 3ff1 (more details), 1.65 Å

PDB Description: structure of glucose 6-phosphate isomerase from staphylococcus aureus
PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d3ff1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ff1a1 c.80.1.2 (A:1-443) automated matches {Staphylococcus aureus [TaxId: 93062]}
mthiqldfsktleffgehelkqqqeivksihktihegtgagsdflgwvdlpvdydkeefs
riveaskrikensdvlvvigiggsylgaraaiemltssfrnsneypeivfvgnhlsstyt
kelvdyladkdfsvnvisksgtttepavafrlfkqlveerygkeeaqkrifattdkekga
lkqlatnegyetfivpddvggrysvltavgllpiataginieammigaakareelssdkl
eeniayqyatirnilyakgyttemlinyepsmqyfnewwkqlfgesegkdfkgiypssan
yttdlhslgqyvqegrrflfetvvkvnhpkyditiekdsddldglnylagktidevntka
fegtllahtdggvpnmvvnipqldeetfgyvvyffelacamsgyqlgvnpfnqpgveayk
qnmfallgkpgfedlkkeleerl

SCOPe Domain Coordinates for d3ff1a1:

Click to download the PDB-style file with coordinates for d3ff1a1.
(The format of our PDB-style files is described here.)

Timeline for d3ff1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ff1a2