SCOPe 2.07: Domain d3ff1a1: 3ff1 A:1-443

Lineage for d3ff1a1 (3ff1 A:1-443)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
   permutation of the double-SIS domain fold
   automatically mapped to Pfam PF00342

6. Protein automated matches [190137] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [188767] (1 PDB entry)

8. Domain d3ff1a1: 3ff1 A:1-443 [175738]
   Other proteins in same PDB: d3ff1a2, d3ff1b2
   automated match to d1b0za_
   complexed with g6q, na

Details for d3ff1a1

PDB Entry: 3ff1, 1.65 Å

PDB Description: structure of glucose 6-phosphate isomerase from staphylococcus aureus

PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d3ff1a1:

Sequence; same for both SEQRES and ATOM records:

>d3ff1a1 c.80.1.2 (A:1-443) automated matches {Staphylococcus aureus [TaxId: 93062]}
mthiqldfsktleffgehelkqqqeivksihktihegtgagsdflgwvdlpvdydkeefs
riveaskrikensdvlvvigiggsylgaraaiemltssfrnsneypeivfvgnhlsstyt
kelvdyladkdfsvnvisksgtttepavafrlfkqlveerygkeeaqkrifattdkekga
lkqlatnegyetfivpddvggrysvltavgllpiataginieammigaakareelssdkl
eeniayqyatirnilyakgyttemlinyepsmqyfnewwkqlfgesegkdfkgiypssan
yttdlhslgqyvqegrrflfetvvkvnhpkyditiekdsddldglnylagktidevntka
fegtllahtdggvpnmvvnipqldeetfgyvvyffelacamsgyqlgvnpfnqpgveayk
qnmfallgkpgfedlkkeleerl

Timeline for d3ff1a1:

• d3ff1a1 first appeared in SCOPe 2.01, called d3ff1a_
  
• d3ff1a1 appears in SCOPe 2.06