SCOPe 2.06: Domain d3feua1: 3feu A:1-182

Lineage for d3feua1 (3feu A:1-182)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Vibrio fischeri [TaxId:312309] [188754] (1 PDB entry)

8. Domain d3feua1: 3feu A:1-182 [175736]
   Other proteins in same PDB: d3feua2
   automated match to d1beda_
   complexed with mg

Details for d3feua1

PDB Entry: 3feu, 1.76 Å

PDB Description: Crystal Structure of DsbA-like thioredoxin domain VF_A0457 from Vibrio fischeri

PDB Compounds: (A:) Putative lipoprotein

SCOPe Domain Sequences for d3feua1:

Sequence; same for both SEQRES and ATOM records:

>d3feua1 c.47.1.0 (A:1-182) automated matches {Vibrio fischeri [TaxId: 312309]}
dpkegvqyevlstslendgmapvtevfalscghcrnmenflpvisqeagtdigkmhitfn
qsahiasmfyyaaemqvdgapdhafmedlfaatqmgegttlteqqeayskaftsrglvsp
ydfneeqrdtlikkvdnakmlseksgissvptfvvngkynvligghddpkqiadtiryll
ek

Timeline for d3feua1:

• d3feua1 first appeared in SCOPe 2.01, called d3feua_
  
• d3feua1 was called d3feua_ in SCOPe 2.05
  
• d3feua1 appears in SCOPe 2.07
  
• d3feua1 appears in the current release, SCOPe 2.08