Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Vibrio fischeri [TaxId:312309] [188754] (1 PDB entry) |
Domain d3feua1: 3feu A:1-182 [175736] Other proteins in same PDB: d3feua2 automated match to d1beda_ complexed with mg |
PDB Entry: 3feu (more details), 1.76 Å
SCOPe Domain Sequences for d3feua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3feua1 c.47.1.0 (A:1-182) automated matches {Vibrio fischeri [TaxId: 312309]} dpkegvqyevlstslendgmapvtevfalscghcrnmenflpvisqeagtdigkmhitfn qsahiasmfyyaaemqvdgapdhafmedlfaatqmgegttlteqqeayskaftsrglvsp ydfneeqrdtlikkvdnakmlseksgissvptfvvngkynvligghddpkqiadtiryll ek
Timeline for d3feua1: