SCOPe 2.01: Domain d3fela_: 3fel A:

Lineage for d3fela_ (3fel A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (30 PDB entries)

8. Domain d3fela_: 3fel A: [175731]
   automated match to d1bm5a_
   complexed with b3p; mutant

Details for d3fela_

PDB Entry: 3fel, 1.85 Å

PDB Description: crystal structure of the r132k:r111l:t54e mutant of cellular retinoic acid-binding protein ii at 1.85 angstrom resolution

PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d3fela_:

Sequence; same for both SEQRES and ATOM records:

>d3fela_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyikesttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
ltmtaddvvctkvyvre

Timeline for d3fela_:

• d3fela_ is new in SCOPe 2.01-stable
  
• d3fela_ appears in SCOPe 2.02
  
• d3fela_ appears in the current release, SCOPe 2.08