Lineage for d3fe7a_ (3fe7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321461Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2321462Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2321625Family a.42.1.0: automated matches [191556] (1 protein)
    not a true family
  6. 2321626Protein automated matches [190960] (1 species)
    not a true protein
  7. 2321627Species Human (Homo sapiens) [TaxId:9606] [188578] (14 PDB entries)
  8. 2321631Domain d3fe7a_: 3fe7 A: [175723]
    automated match to d1ycqa_

Details for d3fe7a_

PDB Entry: 3fe7 (more details), 1.35 Å

PDB Description: crystal structure of hdmx bound to the p53-peptidomimetic ac-phe-met- aib-pmp-trp-glu-ac3c-leu-nh2 at 1.35a
PDB Compounds: (A:) mdm4 protein

SCOPe Domain Sequences for d3fe7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fe7a_ a.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgell
grqsfsvkdpsplydmlrknlvt

SCOPe Domain Coordinates for d3fe7a_:

Click to download the PDB-style file with coordinates for d3fe7a_.
(The format of our PDB-style files is described here.)

Timeline for d3fe7a_: