Lineage for d3fe4b_ (3fe4 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2068693Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2068694Protein automated matches [191011] (13 species)
    not a true protein
  7. 2068743Species Human (Homo sapiens) [TaxId:9606] [188766] (12 PDB entries)
  8. 2068752Domain d3fe4b_: 3fe4 B: [175721]
    automated match to d1rj5b_
    complexed with gol, mg

Details for d3fe4b_

PDB Entry: 3fe4 (more details), 1.9 Å

PDB Description: crystal structure of human carbonic anhydrase vi
PDB Compounds: (B:) Carbonic anhydrase 6

SCOPe Domain Sequences for d3fe4b_:

Sequence, based on SEQRES records: (download)

>d3fe4b_ b.74.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ahwpqhypacggqrqspinlqrtkvrynpslkglnmtgyetqagefpmvnnghtvqislp
stmrmtvadgtvyiaqqmhfhwggasseisgsehtvdgirhvieihivhynskyksydia
qdapdglavlaafvevknypentyysnfishlanikypgqrttltgldvqdmlprnlqhy
ytyhgslttppctenvhwfvladfvklsrtqvwklenslldhrnktihndyrrtqplnhr
vvesnfpn

Sequence, based on observed residues (ATOM records): (download)

>d3fe4b_ b.74.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ahwpqhypacggqrqspinlqrtkvrynpslkglnmtgyetqagefpmvnnghtvqislp
stmrmtvadgtvyiaqqmhfhwggeisgsehtvdgirhvieihivhynskyksydiaqda
pdglavlaafvevknypentyysnfishlanikypgqrttltgldvqdmlprnlqhyyty
hgslttppctenvhwfvladfvklsrtqvwklenslldhrnktihndyrrtqplnhrvve
snfpn

SCOPe Domain Coordinates for d3fe4b_:

Click to download the PDB-style file with coordinates for d3fe4b_.
(The format of our PDB-style files is described here.)

Timeline for d3fe4b_: