SCOPe 2.04: Domain d3fe0a_: 3fe0 A:

Lineage for d3fe0a_ (3fe0 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein automated matches [190299] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188701] (6 PDB entries)

8. Domain d3fe0a_: 3fe0 A: [175719]
   automated match to d1c7pa_
   complexed with dod

Details for d3fe0a_

PDB Entry: 3fe0, 1.5 Å

PDB Description: x-ray crystal structure of wild type human lysozyme in d2o

PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d3fe0a_:

Sequence; same for both SEQRES and ATOM records:

>d3fe0a_ d.2.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d3fe0a_:

• d3fe0a_ first appeared in SCOPe 2.01
  
• d3fe0a_ appears in SCOPe 2.03
  
• d3fe0a_ appears in SCOPe 2.05
  
• d3fe0a_ appears in the current release, SCOPe 2.08