![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
![]() | Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
![]() | Protein Tudor and KH domain-containing protein TDRKH [141205] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141206] (2 PDB entries) Uniprot Q9Y2W6 329-425 |
![]() | Domain d3fdra_: 3fdr A: [175716] automated match to d2diqa1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3fdr (more details), 1.75 Å
SCOPe Domain Sequences for d3fdra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fdra_ b.34.9.1 (A:) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} lqldklvnemtqhyensvpedltvhvgdivaaplptngswyrarvlgtlengnldlyfvd fgdngdcplkdlralrsdflslpfqaiec
Timeline for d3fdra_: