SCOPe 2.08: Domain d3fdoa1: 3fdo A:23-111

Lineage for d3fdoa1 (3fdo A:23-111)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.0: automated matches [191556] (1 protein)
   not a true family

6. Protein automated matches [190960] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188578] (22 PDB entries)

8. Domain d3fdoa1: 3fdo A:23-111 [175715]
   Other proteins in same PDB: d3fdoa2
   automated match to d1ycqa_
   complexed with mg

Details for d3fdoa1

PDB Entry: 3fdo, 1.4 Å

PDB Description: structure of human mdmx in complex with high affinity peptide

PDB Compounds: (A:) Protein Mdm4

SCOPe Domain Sequences for d3fdoa1:

Sequence; same for both SEQRES and ATOM records:

>d3fdoa1 a.42.1.0 (A:23-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllg
ellgrqsfsvkdpsplydmlrknlvtlat

Timeline for d3fdoa1:

• d3fdoa1 first appeared in SCOPe 2.01, called d3fdoa_
  
• d3fdoa1 appears in SCOPe 2.07