Lineage for d3fdmc_ (3fdm C:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1236526Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1236566Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1236567Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1236661Protein automated matches [190236] (2 species)
    not a true protein
  7. 1236662Species Human (Homo sapiens) [TaxId:9606] [188722] (20 PDB entries)
  8. 1236678Domain d3fdmc_: 3fdm C: [175713]
    automated match to d1g5ja_
    complexed with edo

Details for d3fdmc_

PDB Entry: 3fdm (more details), 2.26 Å

PDB Description: alpha/beta foldamer in complex with bcl-xl
PDB Compounds: (C:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d3fdmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fdmc_ f.1.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitpg
tayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndh
lepwiqenggwdtfvelygnn

SCOPe Domain Coordinates for d3fdmc_:

Click to download the PDB-style file with coordinates for d3fdmc_.
(The format of our PDB-style files is described here.)

Timeline for d3fdmc_: