SCOPe 2.07: Domain d3fdma1: 3fdm A:1-198

Lineage for d3fdma1 (3fdm A:1-198)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (88 PDB entries)

8. Domain d3fdma1: 3fdm A:1-198 [175711]
   Other proteins in same PDB: d3fdma2, d3fdmb2
   automated match to d1g5ja_
   complexed with edo

Details for d3fdma1

PDB Entry: 3fdm, 2.26 Å

PDB Description: alpha/beta foldamer in complex with bcl-xl

PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d3fdma1:

Sequence; same for both SEQRES and ATOM records:

>d3fdma1 f.1.4.1 (A:1-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnn

Timeline for d3fdma1:

• d3fdma1 first appeared in SCOPe 2.01, called d3fdma_
  
• d3fdma1 appears in SCOPe 2.06
  
• d3fdma1 appears in the current release, SCOPe 2.08