![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.119: DAK1/DegV-like [82548] (1 superfamily) 2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest] |
![]() | Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) ![]() domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different |
![]() | Family c.119.1.0: automated matches [191443] (1 protein) not a true family |
![]() | Protein automated matches [190655] (13 species) not a true protein |
![]() | Species Eubacterium eligens [TaxId:39485] [188765] (2 PDB entries) |
![]() | Domain d3fdja_: 3fdj A: [175709] automated match to d1pzxb_ complexed with acy, edo, na, p6g, pg4 |
PDB Entry: 3fdj (more details), 1.8 Å
SCOPe Domain Sequences for d3fdja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fdja_ c.119.1.0 (A:) automated matches {Eubacterium eligens [TaxId: 39485]} amrlvadsacdikelrgmvfkavpltistdneefcddgqldihrmldilekhkgrsytac pgidawleafgdddeifvvtitagmsgtynsamaaravyleehpqakvrvidskstgpqm riileqlqqmieegkkfeeidgaidaymqktrlfcslkslhnlaqngrvskvvasaaevl gisvigtasshgtleaigkcrgdkkllvklqallddagyeggklrichvenealadkiad mikqaygttdvcvykagglcsyyaerggiilscetk
Timeline for d3fdja_: