Lineage for d3fdea1 (3fde A:419-626)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824072Family b.122.1.12: SRA domain-like [159368] (2 proteins)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 2824073Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 2824082Species Mouse (Mus musculus) [TaxId:10090] [159371] (10 PDB entries)
    Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625
  8. 2824083Domain d3fdea1: 3fde A:419-626 [175707]
    Other proteins in same PDB: d3fdea2, d3fdeb2
    automated match to d2zo0b1
    complexed with edo, na, unl

Details for d3fdea1

PDB Entry: 3fde (more details), 1.41 Å

PDB Description: Mouse UHRF1 SRA domain bound with hemi-methylated CpG DNA, crystal structure in space group C222(1) at 1.4 A resolution
PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d3fdea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fdea1 b.122.1.12 (A:419-626) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
panhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdng
nyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinekgaeaedwrqgkpvr
vvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryllrrddtepepwtreg
kdrtrqlgltmqypegylealankeksr

SCOPe Domain Coordinates for d3fdea1:

Click to download the PDB-style file with coordinates for d3fdea1.
(The format of our PDB-style files is described here.)

Timeline for d3fdea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fdea2