Lineage for d3fd7b_ (3fd7 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1015692Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1015693Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1015694Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1015999Protein automated matches [190061] (4 species)
    not a true protein
  7. 1016126Species Rana pipiens [TaxId:8404] [188156] (3 PDB entries)
  8. 1016129Domain d3fd7b_: 3fd7 B: [175706]
    automated match to d1onca_
    complexed with edo, gol, so4

Details for d3fd7b_

PDB Entry: 3fd7 (more details), 1.53 Å

PDB Description: crystal structure of onconase c87a/c104a-onc
PDB Compounds: (B:) Protein P-30

SCOPe Domain Sequences for d3fd7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fd7b_ d.5.1.1 (B:) automated matches {Rana pipiens [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfavtcenqapvhfvgvgs

SCOPe Domain Coordinates for d3fd7b_:

Click to download the PDB-style file with coordinates for d3fd7b_.
(The format of our PDB-style files is described here.)

Timeline for d3fd7b_: