SCOPe 2.01: Domain d3fd7b_: 3fd7 B:

Lineage for d3fd7b_ (3fd7 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (4 species)
   not a true protein

7. Species Rana pipiens [TaxId:8404] [188156] (3 PDB entries)

8. Domain d3fd7b_: 3fd7 B: [175706]
   automated match to d1onca_
   complexed with edo, gol, so4

Details for d3fd7b_

PDB Entry: 3fd7, 1.53 Å

PDB Description: crystal structure of onconase c87a/c104a-onc

PDB Compounds: (B:) Protein P-30

SCOPe Domain Sequences for d3fd7b_:

Sequence; same for both SEQRES and ATOM records:

>d3fd7b_ d.5.1.1 (B:) automated matches {Rana pipiens [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfavtcenqapvhfvgvgs

Timeline for d3fd7b_:

• d3fd7b_ is new in SCOPe 2.01-stable
  
• d3fd7b_ appears in SCOPe 2.02
  
• d3fd7b_ appears in the current release, SCOPe 2.08