Lineage for d3fcwf_ (3fcw F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027566Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1027567Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1027789Protein automated matches [190032] (8 species)
    not a true protein
  7. 1027790Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 1027858Domain d3fcwf_: 3fcw F: [175700]
    automated match to d2b8pa1
    complexed with mg, udp; mutant

Details for d3fcwf_

PDB Entry: 3fcw (more details), 2.4 Å

PDB Description: crystal structure of the mimivirus ndk n62l mutant complexed with udp
PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3fcwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fcwf_ d.58.6.1 (F:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
glqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyf
ndlcdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdseds
avdeisiwfp

SCOPe Domain Coordinates for d3fcwf_:

Click to download the PDB-style file with coordinates for d3fcwf_.
(The format of our PDB-style files is described here.)

Timeline for d3fcwf_: