| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein automated matches [190032] (18 species) not a true protein |
| Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries) |
| Domain d3fcwb1: 3fcw B:2-128 [175696] Other proteins in same PDB: d3fcwa2, d3fcwb2, d3fcwc2, d3fcwd2, d3fcwe2, d3fcwf2 automated match to d2b8pa1 complexed with mg, udp; mutant |
PDB Entry: 3fcw (more details), 2.4 Å
SCOPe Domain Sequences for d3fcwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fcwb1 d.58.6.1 (B:2-128) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwf
Timeline for d3fcwb1: