SCOPe 2.06: Domain d3fcva1: 3fcv A:2-134

Lineage for d3fcva1 (3fcv A:2-134)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3fcva1: 3fcv A:2-134 [175693]
   Other proteins in same PDB: d3fcva2, d3fcvb2
   automated match to d2b8pa1
   complexed with dud, mg; mutant

Details for d3fcva1

PDB Entry: 3fcv, 2.4 Å

PDB Description: crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with dudp

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3fcva1:

Sequence; same for both SEQRES and ATOM records:

>d3fcva1 d.58.6.1 (A:2-134) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandigenlihasdse
dsavdeisiwfpe

Timeline for d3fcva1:

• d3fcva1 first appeared in SCOPe 2.01, called d3fcva_
  
• d3fcva1 was called d3fcva_ in SCOPe 2.05
  
• d3fcva1 appears in SCOPe 2.07
  
• d3fcva1 appears in the current release, SCOPe 2.08