Class b: All beta proteins [48724] (174 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (1 family) |
Family b.69.8.1: Integrin alpha N-terminal domain [69319] (1 protein) |
Protein Integrin alpha N-terminal domain [69320] (2 species) |
Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (13 PDB entries) Uniprot P08514 32-483 |
Domain d3fcuc_: 3fcu C: [175691] automated match to d1tyea_ complexed with ca, cac, mg, nag |
PDB Entry: 3fcu (more details), 2.9 Å
SCOPe Domain Sequences for d3fcuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fcuc_ b.69.8.1 (C:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]} nldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwrae ggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlektee aektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqagel vlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysvav gefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvngd grhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsaia plgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfsl rgavdiddngypdlivgayganqvavyraqp
Timeline for d3fcuc_: