SCOPe 2.08: Domain d3fcda1: 3fcd A:4-124

Lineage for d3fcda1 (3fcd A:4-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [188712] (1 PDB entry)

8. Domain d3fcda1: 3fcd A:4-124 [175685]
   Other proteins in same PDB: d3fcda2, d3fcdb2
   automated match to d1jiea_

Details for d3fcda1

PDB Entry: 3fcd, 1.92 Å

PDB Description: crystal structure of a putative glyoxalase from an environmental bacteria

PDB Compounds: (A:) Lyase

SCOPe Domain Sequences for d3fcda1:

Sequence, based on SEQRES records:

>d3fcda1 d.32.1.0 (A:4-124) automated matches {Uncultured bacterium [TaxId: 77133]}
ihqitpflhipdmqealtlfcdtlgfelkyrhsnyaylelsgcglrlleeparkiipdgi
arvaicidvsdidslhtklspalenlpadqveplknmpygqrefqvrmpdgdwlnftapl
a

Sequence, based on observed residues (ATOM records):

>d3fcda1 d.32.1.0 (A:4-124) automated matches {Uncultured bacterium [TaxId: 77133]}
ihqitpflhipdmqealtlfcdtlgfelkyrhsnyaylelsgcglrlleeparvaicidv
sdidslhtklspalenlpadqveplknmpygqrefqvrmpdgdwlnftapla

Timeline for d3fcda1:

• d3fcda1 first appeared in SCOPe 2.01, called d3fcda_
  
• d3fcda1 appears in SCOPe 2.07