SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3fcda1 (3fcd A:4-124)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2166686Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2166687Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2167144Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2167145Protein automated matches [190239] (18 species)
    not a true protein
  7. 2167281Species Uncultured bacterium [TaxId:77133] [188712] (1 PDB entry)
  8. 2167282Domain d3fcda1: 3fcd A:4-124 [175685]
    Other proteins in same PDB: d3fcda2, d3fcdb2
    automated match to d1jiea_

Details for d3fcda1

PDB Entry: 3fcd (more details), 1.92 Å

PDB Description: Crystal Structure of a putative glyoxalase from an environmental bacteria
PDB Compounds: (A:) Lyase

SCOPe Domain Sequences for d3fcda1:

Sequence, based on SEQRES records: (download)

>d3fcda1 d.32.1.0 (A:4-124) automated matches {Uncultured bacterium [TaxId: 77133]}
ihqitpflhipdmqealtlfcdtlgfelkyrhsnyaylelsgcglrlleeparkiipdgi
arvaicidvsdidslhtklspalenlpadqveplknmpygqrefqvrmpdgdwlnftapl
a

Sequence, based on observed residues (ATOM records): (download)

>d3fcda1 d.32.1.0 (A:4-124) automated matches {Uncultured bacterium [TaxId: 77133]}
ihqitpflhipdmqealtlfcdtlgfelkyrhsnyaylelsgcglrlleeparvaicidv
sdidslhtklspalenlpadqveplknmpygqrefqvrmpdgdwlnftapla

SCOPe Domain Coordinates for d3fcda1:

Click to download the PDB-style file with coordinates for d3fcda1.
(The format of our PDB-style files is described here.)

Timeline for d3fcda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fcda2