Lineage for d3fcaa_ (3fca A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2156900Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2157154Protein automated matches [190054] (13 species)
    not a true protein
  7. 2157248Species Thermus thermophilus [TaxId:274] [188788] (1 PDB entry)
  8. 2157249Domain d3fcaa_: 3fca A: [175681]
    automated match to d1o58a_
    complexed with zn

Details for d3fcaa_

PDB Entry: 3fca (more details), 2.15 Å

PDB Description: genetic incorporation of a metal-ion chelating amino acid into proteins as biophysical probe
PDB Compounds: (A:) Cysteine synthase

SCOPe Domain Sequences for d3fcaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fcaa_ c.79.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
mmerligstpivrldsidsrixlkleknnpggsvkdrpalfmildaekrgllkngivept
sgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpgelgmkgavekale
isretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvlkg
ffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvidevitvedeeayem
arylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaerylsil

SCOPe Domain Coordinates for d3fcaa_:

Click to download the PDB-style file with coordinates for d3fcaa_.
(The format of our PDB-style files is described here.)

Timeline for d3fcaa_: