SCOPe 2.05: Domain d3fc9f_: 3fc9 F:

Lineage for d3fc9f_ (3fc9 F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (15 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3fc9f_: 3fc9 F: [175680]
   automated match to d2b8pa1
   complexed with cdp, ctp, mg; mutant

Details for d3fc9f_

PDB Entry: 3fc9, 2.8 Å

PDB Description: crystal structure of the mimivirus ndk +kpn-n62l double mutant complexed with cdp

PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3fc9f_:

Sequence; same for both SEQRES and ATOM records:

>d3fc9f_ d.58.6.1 (F:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
lqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfn
dlcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenlihasds
edsavdeisiwfp

Timeline for d3fc9f_:

• d3fc9f_ first appeared in SCOPe 2.01
  
• d3fc9f_ appears in SCOPe 2.04
  
• d3fc9f_ is called d3fc9f1 in SCOPe 2.06
  
• d3fc9f_ appears in the current release, SCOPe 2.08, called d3fc9f1