Lineage for d3fc9f1 (3fc9 F:2-133)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951328Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 2951394Domain d3fc9f1: 3fc9 F:2-133 [175680]
    Other proteins in same PDB: d3fc9a2, d3fc9b2, d3fc9c2, d3fc9d2, d3fc9e2, d3fc9f2
    automated match to d2b8pa1
    complexed with cdp, ctp, mg; mutant

Details for d3fc9f1

PDB Entry: 3fc9 (more details), 2.8 Å

PDB Description: crystal structure of the mimivirus ndk +kpn-n62l double mutant complexed with cdp
PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3fc9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fc9f1 d.58.6.1 (F:2-133) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenlihasdse
dsavdeisiwfp

SCOPe Domain Coordinates for d3fc9f1:

Click to download the PDB-style file with coordinates for d3fc9f1.
(The format of our PDB-style files is described here.)

Timeline for d3fc9f1: