| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein automated matches [190032] (18 species) not a true protein |
| Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries) |
| Domain d3fc9b1: 3fc9 B:2-133 [175676] Other proteins in same PDB: d3fc9a2, d3fc9b2, d3fc9c2, d3fc9d2, d3fc9e2, d3fc9f2 automated match to d2b8pa1 complexed with cdp, ctp, mg; mutant |
PDB Entry: 3fc9 (more details), 2.8 Å
SCOPe Domain Sequences for d3fc9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fc9b1 d.58.6.1 (B:2-133) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenlihasdse
dsavdeisiwfp
Timeline for d3fc9b1: