Lineage for d3fc9a_ (3fc9 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) 
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) 
Protein automated matches [190032] (15 species)
not a true protein
Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries) 
Domain d3fc9a_: 3fc9 A: [175675]
automated match to d2b8pa1
complexed with cdp, ctp, mg; mutant
Details for d3fc9a_
PDB Entry: 3fc9 (more details), 2.8 Å
PDB Description: crystal structure of the mimivirus ndk +kpn-n62l double mutant complexed with cdp
PDB Compounds: (A:) Nucleoside diphosphate kinaseSCOPe Domain Sequences for d3fc9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fc9a_ d.58.6.1 (A:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
lqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfn
dlcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenlihasds
edsavdeisiwfpe
SCOPe Domain Coordinates for d3fc9a_:
Click to download the PDB-style file with coordinates for d3fc9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3fc9a_:
- d3fc9a_ first appeared in SCOPe 2.01
- d3fc9a_ appears in SCOPe 2.04
- d3fc9a_ is called d3fc9a1 in SCOPe 2.06
- d3fc9a_ appears in the current release, SCOPe 2.08, called d3fc9a1
View in 3D
