SCOPe 2.08: Domain d3fc9a1: 3fc9 A:2-134

Lineage for d3fc9a1 (3fc9 A:2-134)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3fc9a1: 3fc9 A:2-134 [175675]
   Other proteins in same PDB: d3fc9a2, d3fc9b2, d3fc9c2, d3fc9d2, d3fc9e2, d3fc9f2
   automated match to d2b8pa1
   complexed with cdp, ctp, mg; mutant

Details for d3fc9a1

PDB Entry: 3fc9, 2.8 Å

PDB Description: crystal structure of the mimivirus ndk +kpn-n62l double mutant complexed with cdp

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3fc9a1:

Sequence; same for both SEQRES and ATOM records:

>d3fc9a1 d.58.6.1 (A:2-134) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenlihasdse
dsavdeisiwfpe

Timeline for d3fc9a1:

• d3fc9a1 first appeared in SCOPe 2.01, called d3fc9a_
  
• d3fc9a1 appears in SCOPe 2.07