Lineage for d3fc6a_ (3fc6 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342369Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2342370Species Human (Homo sapiens) [TaxId:9606] [48511] (39 PDB entries)
    Uniprot P19793 227-458
  8. 2342381Domain d3fc6a_: 3fc6 A: [175671]
    Other proteins in same PDB: d3fc6b_, d3fc6d_
    automated match to d1lbda_
    complexed with lx2, rea

Details for d3fc6a_

PDB Entry: 3fc6 (more details), 2.06 Å

PDB Description: hRXRalpha & mLXRalpha with an indole Pharmacophore, SB786875
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d3fc6a_:

Sequence, based on SEQRES records: (download)

>d3fc6a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
sanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea

Sequence, based on observed residues (ATOM records): (download)

>d3fc6a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
sanedmpverileaelavdpvtnicqaadkqlftlvewakriphfselplddqvillrag
wnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdk
telgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpa
lrsiglkclehlfffkldtflmemlea

SCOPe Domain Coordinates for d3fc6a_:

Click to download the PDB-style file with coordinates for d3fc6a_.
(The format of our PDB-style files is described here.)

Timeline for d3fc6a_: