| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class pi GST [81347] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries) |
| Domain d7gssb1: 7gss B:77-209 [17567] Other proteins in same PDB: d7gssa2, d7gssb2 complexed with gsh, mes |
PDB Entry: 7gss (more details), 2.2 Å
SCOPe Domain Sequences for d7gssb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7gssb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq
Timeline for d7gssb1: