![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein MAP kinase p38 [56129] (2 species) CMGC group; ERK/MAPK subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56130] (204 PDB entries) |
![]() | Domain d3fc1x_: 3fc1 X: [175668] automated match to d1a9ua_ complexed with 52p, cl |
PDB Entry: 3fc1 (more details), 2.4 Å
SCOPe Domain Sequences for d3fc1x_:
Sequence, based on SEQRES records: (download)
>d3fc1x_ d.144.1.7 (X:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppl
>d3fc1x_ d.144.1.7 (X:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} rptfyrqelniwevperyqnlspvgsvcaafdtktglrvavkklsrpfqsiihakrtyre lrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvqfli yqilrglkyihsadiihrdlkpsnlavnedcelkildfgmtgyvatrwyrapeimlnwmh ynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyi qsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepv adpydqsfesrdllidewksltydevisfvpppl
Timeline for d3fc1x_: