Lineage for d3fbkb_ (3fbk B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038265Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2038266Protein automated matches [190497] (4 species)
    not a true protein
  7. 2038269Species Human (Homo sapiens) [TaxId:9606] [188711] (22 PDB entries)
  8. 2038275Domain d3fbkb_: 3fbk B: [175664]
    automated match to d1dsya_
    complexed with so4

Details for d3fbkb_

PDB Entry: 3fbk (more details), 2 Å

PDB Description: Crystal structure of the C2 domain of the human regulator of G-protein signaling 3 isoform 6 (RGP3), Northeast Structural Genomics Consortium Target HR5550A
PDB Compounds: (B:) Regulator of G-protein signaling 3

SCOPe Domain Sequences for d3fbkb_:

Sequence, based on SEQRES records: (download)

>d3fbkb_ b.7.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqgagqlrlsidaqdrvlllhiiegkgliskqpgtcdpyvkislipedsrlrhqktqtvp
dcrdpafhehfffpvqeeddqkrllvtvwnrasqsrqsgligcmsfgvkslltpdkeisg
wyyllgehlgrtkhlkvarrr

Sequence, based on observed residues (ATOM records): (download)

>d3fbkb_ b.7.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqgagqlrlsidaqdrvlllhiiegkgliskqpgtcdpyvkislipedsrlrhqktqtvp
dcrdpafhehfffpvqeeddqkrllvtvwnrasqsrqsgligcmsfgvksllteisgwyy
llgehlgrtkhlkvarrr

SCOPe Domain Coordinates for d3fbkb_:

Click to download the PDB-style file with coordinates for d3fbkb_.
(The format of our PDB-style files is described here.)

Timeline for d3fbkb_: