| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein automated matches [190032] (18 species) not a true protein |
| Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries) |
| Domain d3fbef1: 3fbe F:2-129 [175656] Other proteins in same PDB: d3fbea2, d3fbeb2, d3fbec2, d3fbed2, d3fbee2, d3fbef2 automated match to d2b8pa1 complexed with gdp, mg; mutant |
PDB Entry: 3fbe (more details), 2.4 Å
SCOPe Domain Sequences for d3fbef1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fbef1 d.58.6.1 (F:2-129) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandigenlihasdsedsav
deisiwfp
Timeline for d3fbef1: